OTUD3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-90485
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: OTUD3 Protein
• Description: Rabbit Polyclonal
• Gene: OTUD3
• Conjugate: Unconjugated

Product images

Western Blot: OTUD3 Antibody [NBP1-90485] - Analysis in human cell line RH-30.

Immunocytochemistry/Immunofluorescence: OTUD3 Antibody [NBP1-90485] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & intermediate filaments.

Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: OTUD3 Antibody [NBP1-90485] - Staining of human breast shows moderate cytoplasmic positivity in glandular cells.