C19orf66 Antibody
| Name | C19orf66 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90417 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KFHGKASSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C19orf66 Protein |
| Description | Rabbit Polyclonal |
| Gene | C19orf66 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C19orf66 Antibody [NBP1-90417] - Analysis in human cell line HDLM-2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14045_C19orf66-Antibody-Western-Blot-NBP1-90417-img0007.jpg)
Western Blot: C19orf66 Antibody [NBP1-90417] - Analysis in human cell line HDLM-2.
![Immunocytochemistry/Immunofluorescence: C19orf66 Antibody [NBP1-90417] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14046_C19orf66-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90417-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C19orf66 Antibody [NBP1-90417] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: C19orf66 Antibody [NBP1-90417] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14047_C19orf66-Antibody-Immunohistochemistry-Paraffin-NBP1-90417-img0002.jpg)
Immunohistochemistry-Paraffin: C19orf66 Antibody [NBP1-90417] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts and Leydig cells.