MURF3 Antibody
| Name | MURF3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92154 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MURF3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRIM54 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MURF3 Antibody [NBP1-92154] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-363](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16119_MURF3-Antibody-Western-Blot-NBP1-92154-img0006.jpg)
Western Blot: MURF3 Antibody [NBP1-92154] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-363
![Immunocytochemistry/Immunofluorescence: MURF3 Antibody [NBP1-92154] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16120_MURF3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92154-img0004.jpg)
Immunocytochemistry/Immunofluorescence: MURF3 Antibody [NBP1-92154] - Staining of human cell line U-2 OS shows positivity in plasma membrane and cytoplasm.
![Immunohistochemistry-Paraffin: MURF3 Antibody [NBP1-92154] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16121_MURF3-Antibody-Immunohistochemistry-Paraffin-NBP1-92154-img0002.jpg)
Immunohistochemistry-Paraffin: MURF3 Antibody [NBP1-92154] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.