NULP1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-92211
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:QEWEAHRNLSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLLIQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEISQ
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: NULP1 Protein
• Description: Rabbit Polyclonal
• Gene: TCF25
• Conjugate: Unconjugated

Product images

Western Blot: NULP1 Antibody [NBP1-92211] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: NULP1 Antibody [NBP1-92211] - Staining of human uterus, pre-menopause, shows strong cytoplasmic positivity in glandular cells.

Western Blot: NULP1 Antibody [NBP1-92211] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp