LYPLAL1 Antibody
| Name | LYPLAL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92090 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LYPLAL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LYPLAL1 |
| Supplier Page | Shop |
Product images
![Western Blot: LYPLAL1 Antibody [NBP1-92090] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408395)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25141_LYPLAL1%2520Antibody-Western%2520Blot-NBP1-92090-img0004.jpg)
Western Blot: LYPLAL1 Antibody [NBP1-92090] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408395)
![Immunocytochemistry/Immunofluorescence: LYPLAL1 Antibody [NBP1-92090] - Staining of human cell line U-251 MG shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25142_LYPLAL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92090-img0003.jpg)
Immunocytochemistry/Immunofluorescence: LYPLAL1 Antibody [NBP1-92090] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: LYPLAL1 Antibody [NBP1-92090] - Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25143_LYPLAL1-Antibody-Immunohistochemistry-Paraffin-NBP1-92090-img0002.jpg)
Immunohistochemistry-Paraffin: LYPLAL1 Antibody [NBP1-92090] - Staining of human stomach, upper shows strong cytoplasmic and nuclear positivity in glandular cells.
![Simple Western: LYPLAL1 Antibody [NBP1-92090] - Simple Western lane view shows a specific band for LYPLAL1 in 0.2 mg/ml of SK-MEL-28 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/22874_LYPLAL1-Antibody-Simple-Western-NBP1-92090-img0005.jpg)
Simple Western: LYPLAL1 Antibody [NBP1-92090] - Simple Western lane view shows a specific band for LYPLAL1 in 0.2 mg/ml of SK-MEL-28 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.