Methionyl tRNA synthetase 2 Antibody
| Name | Methionyl tRNA synthetase 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92106 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:WLGTVLHVALECLRVFGTLLQPVTPSLADKLLSRLGVSASERSLGELYFLPRFYGHPCPFEGRRLGPETGLLFPRLDQSRTWLVKAHRT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Methionyl tRNA synthetase 2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MARS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-336](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12761_Methionyl-tRNA-synthetase-2-Antibody-Western-Blot-NBP1-92106-img0006.jpg)
Western Blot: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-336
![Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments & aggresome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12762_Methionyl%2520tRNA%2520synthetase%25202%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92106-img0007.jpg)
Immunocytochemistry/Immunofluorescence: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Immunofluorescent staining of human cell line U-2 OS shows localization to intermediate filaments & aggresome.
![Immunohistochemistry-Paraffin: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12763_Methionyl-tRNA-synthetase-2-Antibody-Immunohistochemistry-Paraffin-NBP1-92106-img0002.jpg)
Immunohistochemistry-Paraffin: Methionyl tRNA synthetase 2 Antibody [NBP1-92106] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.