Ly-6G5C Antibody

Name Ly-6G5C Antibody
Supplier Novus Biologicals
Catalog NBP1-91160
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:ADLPSCWGAGPCYTGHKVGALRRDTVICCCRHGDYSTPCLFTPGKPSRNPSPWKRTLWT
Purity/Format Immunogen affinity purified
Blocking Peptide Ly-6G5C Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene LY6G5C
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.