SLC22A23 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-91154
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:PESRDQNLPENISNGEHYTRQPLLPHKKGEQPLLLTNAELKDYSGLHDAAAAGDTLPEGATANGMKAM
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SLC22A23 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SLC22A23
• Conjugate: Unconjugated

Product images

Western Blot: SLC22A23 Antibody [NBP1-91154] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: SLC22A23 Antibody [NBP1-91154] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.

Immunohistochemistry-Paraffin: SLC22A23 Antibody [NBP1-91154] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.