Glycogen synthase 2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-91191
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:VPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: Glycogen synthase 2 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: GYS2
• Conjugate: Unconjugated

Product images

Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: Glycogen synthase 2 Antibody [NBP1-91191] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.

Immunohistochemistry-Paraffin: Glycogen synthase 2 Antibody [NBP1-91191] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Western Blot: Glycogen synthase 2 Antibody [NBP1-91191] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate