FOXS1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-91911
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:FTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPK
• Purity/Format: Affinity purified
• Blocking Peptide: FOXS1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: FOXS1

Product images

Immunocytochemistry/Immunofluorescence: FOXS1 Antibody [NBP1-91911] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.

Immunohistochemistry-Paraffin: FOXS1 Antibody [NBP1-91911] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Western Blot: FOXS1 Antibody [NBP1-91911] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp