SFRS7 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-92382
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:SRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGE
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SFRS7 Protein
• Description: Rabbit Polyclonal
• Gene: SRSF7
• Conjugate: Unconjugated

Product images

Western Blot: SFRS7 Antibody [NBP1-92382] - Analysis in control (vector only transfected HEK293T lysate) and sRSF7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: SFRS7 Antibody [NBP1-92382] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: SFRS7 Antibody [NBP1-92382] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.