Troponin T Type 3 (fast skeletal) Antibody
| Name | Troponin T Type 3 (fast skeletal) Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92534 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Troponin T Type 3 (fast skeletal) Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TNNT3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10184_Troponin-T-Type-3-(fast-skeletal)-Antibody-Western-Blot-NBP1-92534-img0003.jpg)
Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
![Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10185_Troponin-T-Type-3-(fast-skeletal)-Antibody-Immunohistochemistry-Paraffin-NBP1-92534-img0002.jpg)
Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.