STK38L Antibody
| Name | STK38L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92454 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | STK38L Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | STK38L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: STK38L Antibody [NBP1-92454] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6436_STK38L-Antibody-Western-Blot-NBP1-92454-img0005.jpg)
Western Blot: STK38L Antibody [NBP1-92454] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunohistochemistry-Paraffin: STK38L Antibody [NBP1-92454] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6437_STK38L-Antibody-Immunohistochemistry-Paraffin-NBP1-92454-img0006.jpg)
Immunohistochemistry-Paraffin: STK38L Antibody [NBP1-92454] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells and non-germinal center cells.