TBC1D13 Antibody

Name TBC1D13 Antibody
Supplier Novus Biologicals
Catalog NBP1-92477
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:EDHPLNPNPDSRWNTYFKDNEVLLQIDKDVRRLCPDISFFQRATDYPCLLILDPQNEFETLRKRVEQTTLKSQTVAR
Purity/Format Immunogen affinity purified
Blocking Peptide TBC1D13 Protein
Description Rabbit Polyclonal
Gene TBC1D13
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.