C6orf163 Antibody
| Name | C6orf163 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-94165 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVCNKIIPPAPFGKTFKRIHEYKPLKTRFYTHKDILDIGANILKKEEQFQEDILREHIAKAEAEVWAQANERQKQAVEKALEEAND |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C6orf163 Protein |
| Description | Rabbit Polyclonal |
| Gene | C6orf163 |
| Supplier Page | Shop |
Product images
![Western Blot: C6orf163 Antibody [NBP1-94165] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25617_C6orf163%2520Antibody-Western%2520Blot-NBP1-94165-img0005.jpg)
Western Blot: C6orf163 Antibody [NBP1-94165] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: C6orf163 Antibody [NBP1-94165] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25618_C6orf163-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-94165-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C6orf163 Antibody [NBP1-94165] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: C6orf163 Antibody [NBP1-94165] - Staining of human kidney shows strong cytoplasmic positivity in - cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25619_C6orf163-Antibody-Immunohistochemistry-Paraffin-NBP1-94165-img0002.jpg)
Immunohistochemistry-Paraffin: C6orf163 Antibody [NBP1-94165] - Staining of human kidney shows strong cytoplasmic positivity in - cells in tubules.