CCDC151 Antibody
| Name | CCDC151 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93507 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:REASGKPSHLRGKGTAQAWTPGRSKGGSFHRGAGKPSVHSQVAELHKKIQLLEGDRKAFFESSQWNIKKNQETISQLR |
| Description | Rabbit Polyclonal |
| Gene | CCDC151 |
| Supplier Page | Shop |
Product images
![Western Blot: CCDC151 Antibody [NBP1-93507] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25776_CCDC151%2520Antibody-Western%2520Blot-NBP1-93507-img0005.jpg)
Western Blot: CCDC151 Antibody [NBP1-93507] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: CCDC151 Antibody [NBP1-93507] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25777_CCDC151-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93507-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CCDC151 Antibody [NBP1-93507] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: CCDC151 Antibody [NBP1-93507] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/25778_CCDC151-Antibody-Immunohistochemistry-Paraffin-NBP1-93507-img0002.jpg)
Immunohistochemistry-Paraffin: CCDC151 Antibody [NBP1-93507] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.