ALAS2 Antibody
| Name | ALAS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54728 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ALAS2(aminolevulinate, delta-, synthase 2 (sideroblastic/hypochromic anemia)) The peptide sequence was selected from the N terminal of ALAS2. Peptide sequence VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQ |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ALAS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ALAS2 Antibody [NBP1-54728] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14599_ALAS2-Antibody-Western-Blot-NBP1-54728-img0003.jpg)
Western Blot: ALAS2 Antibody [NBP1-54728] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.
![Immunohistochemistry-Paraffin: ALAS2 Antibody [NBP1-54728] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14600_ALAS2-Antibody-Immunohistochemistry-Paraffin-NBP1-54728-img0004.jpg)
Immunohistochemistry-Paraffin: ALAS2 Antibody [NBP1-54728] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.