TST Antibody
| Name | TST Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54682 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TST(thiosulfate sulfurtransferase (rhodanese)) The peptide sequence was selected from the middle region of TST. Peptide sequence GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TST |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TST Antibody [NBP1-54682] - Jurkat cell lysate, concentration 1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29998_TST-Antibody-Western-Blot-NBP1-54682-img0001.jpg)
Western Blot: TST Antibody [NBP1-54682] - Jurkat cell lysate, concentration 1 ug/ml.
![Immunohistochemistry: TST Antibody [NBP1-54682] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29999_TST-Antibody-Immunohistochemistry-NBP1-54682-img0004.jpg)
Immunohistochemistry: TST Antibody [NBP1-54682] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.
![Immunohistochemistry-Paraffin: TST Antibody [NBP1-54682] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/0_TST-Antibody-Immunohistochemistry-Paraffin-NBP1-54682-img0002.jpg)
Immunohistochemistry-Paraffin: TST Antibody [NBP1-54682] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
![Immunohistochemistry: TST Antibody [NBP1-54682] - Analysis of human small intestine after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/1_TST-Antibody-Immunohistochemistry-NBP1-54682-img0003.jpg)
Immunohistochemistry: TST Antibody [NBP1-54682] - Analysis of human small intestine after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.