S100A3 Antibody
| Name | S100A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54679 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to S100A3(S100 calcium binding protein A3) The peptide sequence was selected from the N terminal of S100A3. Peptide sequence MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | S100A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: S100A3 Antibody [NBP1-54679] - OVCAR-3 cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22677_S100A3-Antibody-Western-Blot-NBP1-54679-img0001.jpg)
![Immunohistochemistry-Paraffin: S100A3 Antibody [NBP1-54679] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22678_S100A3-Antibody-Immunohistochemistry-Paraffin-NBP1-54679-img0002.jpg)