TBC1D1 Antibody
| Name | TBC1D1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54654 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig |
| Antigen | Synthetic peptides corresponding to TBC1D1(TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1) The peptide sequence was selected from the middle region of TBC1D1. Peptide sequence RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TBC1D1 |
| Supplier Page | Shop |
![Western Blot: TBC1D1 Antibody [NBP1-54654] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/28832_TBC1D1%2520Antibody-Western%2520Blot-NBP1-54654-img0004.jpg)
![Immunohistochemistry-Paraffin: TBC1D1 Antibody [NBP1-54654] - Human Kidney tissue, 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/28833_TBC1D1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-54654-img0003.jpg)