MGST2 Antibody
| Name | MGST2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59066 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MGST2(microsomal glutathione S-transferase 2) The peptide sequence was selected from the N terminal of MGST2. Peptide sequence MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MGST2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MGST2 Antibody [NBP1-59066] - HepG2 cell lysate, concentration 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24845_MGST2-Antibody-Western-Blot-NBP1-59066-img0001.jpg)
![Immunohistochemistry-Paraffin: MGST2 Antibody [NBP1-59066] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24846_MGST2-Antibody-Immunohistochemistry-Paraffin-NBP1-59066-img0003.jpg)