TSPAN2 Antibody

Name TSPAN2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59226
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TSPAN2(tetraspanin 2) The peptide sequence was selected from the middle region of TSPAN2. Peptide sequence FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TSPAN2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.