Name | TSPAN2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59226 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TSPAN2(tetraspanin 2) The peptide sequence was selected from the middle region of TSPAN2. Peptide sequence FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | TSPAN2 |
Conjugate | Unconjugated |
Supplier Page | Shop |