Claudin-8 Antibody
| Name | Claudin-8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59157 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CLDN8 (claudin 8) The peptide sequence was selected from the C terminal of CLDN8. Peptide sequence IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CLDN8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Claudin-8 Antibody [NBP1-59157] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19826_Claudin-8-Antibody-Western-Blot-NBP1-59157-img0009.jpg)
Western Blot: Claudin-8 Antibody [NBP1-59157] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
![Immunohistochemistry: Claudin-8 Antibody [NBP1-59157] - Human Intestine](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19827_Claudin-8-Antibody-Immunohistochemistry-NBP1-59157-img0008.jpg)
Immunohistochemistry: Claudin-8 Antibody [NBP1-59157] - Human Intestine
![Western Blot: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - HepG2 cell lysate, Antibody Titration: 0.5-1.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19828_Claudin-8-Antibody-Western-Blot-NBP1-59157-img0007.jpg)
Western Blot: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - HepG2 cell lysate, Antibody Titration: 0.5-1.0ug/ml
![Immunohistochemistry-Paraffin: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19829_Claudin-8-Antibody-Immunohistochemistry-Paraffin-NBP1-59157-img0006.jpg)
Immunohistochemistry-Paraffin: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.