Connexin 58/GJA9 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59196
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to GJA9(gap junction protein, alpha 9, 59kDa) The peptide sequence was selected from the middle region of GJA9. Peptide sequence IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GJA9
• Conjugate: Unconjugated

Product images

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Brain lysate, concentration 0.2-1 ug/ml.

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Fetal Muscle.

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Fetal Liver.

Western Blot: Connexin 58/GJA9 Antibody [NBP1-59196] - Human Adult Placenta.