SNRPA1 Antibody
| Name | SNRPA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57239 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Pig, Bovine, Dog, Rabbit |
| Antigen | Synthetic peptides corresponding to SNRPA1 (small nuclear ribonucleoprotein polypeptide A') The peptide sequence was selected from the C terminal of SNRPA1. Peptide sequence RRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQ. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | SNRPA1 |
| Supplier Page | Shop |
Product images
![Western Blot: SNRPA1 Antibody [NBP1-57239] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/28888_SNRPA1%2520Antibody-Western%2520Blot-NBP1-57239-img0001.jpg)
Western Blot: SNRPA1 Antibody [NBP1-57239] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
![Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP1-57239] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/28889_SNRPA1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-57239-img0002.jpg)
Immunohistochemistry-Paraffin: SNRPA1 Antibody [NBP1-57239] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.