KIAA0020 Antibody
| Name | KIAA0020 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57531 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to KIAA0020 (KIAA0020) The peptide sequence was selected from the N terminal of KIAA0020. Peptide sequence GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | KIAA0020 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KIAA0020 Antibody [NBP1-57531] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14506_KIAA0020-Antibody-Western-Blot-NBP1-57531-img0001.jpg)
Western Blot: KIAA0020 Antibody [NBP1-57531] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry: KIAA0020 Antibody [NBP1-57531] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14507_KIAA0020-Antibody-Immunohistochemistry-NBP1-57531-img0003.jpg)
Immunohistochemistry: KIAA0020 Antibody [NBP1-57531] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
![Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-57531] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14508_KIAA0020-Antibody-Immunohistochemistry-Paraffin-NBP1-57531-img0002.jpg)
Immunohistochemistry-Paraffin: KIAA0020 Antibody [NBP1-57531] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.