PEX7 Antibody

Name PEX7 Antibody
Supplier Novus Biologicals
Catalog NBP1-57578
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7. Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PEX7
Conjugate Unconjugated
Supplier Page Shop

Product images