MIF4GD Antibody
| Name | MIF4GD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57562 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MIF4GD (MIF4G domain containing) The peptide sequence was selected from the C terminal of MIF4GD. Peptide sequence LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MIF4GD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MIF4GD Antibody [NBP1-57562] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24351_MIF4GD-Antibody-Western-Blot-NBP1-57562-img0001.jpg)
Western Blot: MIF4GD Antibody [NBP1-57562] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: MIF4GD Antibody [NBP1-57562] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24352_MIF4GD-Antibody-Immunohistochemistry-Paraffin-NBP1-57562-img0003.jpg)
Immunohistochemistry-Paraffin: MIF4GD Antibody [NBP1-57562] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.