NUDT21 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57540
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to NUDT21 (nudix (nucleoside diphosphate linked moiety X)-type motif 21) The peptide sequence was selected from the N terminal of NUDT21. Peptide sequence TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSV
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: NUDT21
• Conjugate: Unconjugated