SH3BGRL Antibody

Name SH3BGRL Antibody
Supplier Novus Biologicals
Catalog NBP1-57643
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF
Species Reactivities Human
Antigen Synthetic peptides corresponding to SH3BGRL(SH3 domain binding glutamic acid-rich protein like) The peptide sequence was selected from the middle region of SH3BGRL. Peptide sequence PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SH3BGRL
Conjugate Unconjugated
Supplier Page Shop

Product images