SH3BGRL Antibody
| Name | SH3BGRL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57643 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SH3BGRL(SH3 domain binding glutamic acid-rich protein like) The peptide sequence was selected from the middle region of SH3BGRL. Peptide sequence PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SH3BGRL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SH3BGRL Antibody [NBP1-57643] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24444_SH3BGRL-Antibody-Western-Blot-NBP1-57643-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: SH3BGRL Antibody [NBP1-57643] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell bodies of pinealocytes](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24445_SH3BGRL-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-57643-img0003.jpg)