CPEB3 Antibody
| Name | CPEB3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56919 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CPEB3(cytoplasmic polyadenylation element binding protein 3) The peptide sequence was selected from the middle region of CPEB3 (NP_055727). Peptide sequence RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CPEB3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CPEB3 Antibody [NBP1-56919] - Analysis of 721_B whole cell Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml lysate Quantity: 25ug/ Lane Gel Concentration: 0.12%.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7380_CPEB3%2520Antibody-Western%2520Blot-NBP1-56919-img0004.jpg)
Western Blot: CPEB3 Antibody [NBP1-56919] - Analysis of 721_B whole cell Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml lysate Quantity: 25ug/ Lane Gel Concentration: 0.12%.
![Western Blot: CPEB3 Antibody [NBP1-56919] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7381_CPEB3-Antibody-Western-Blot-NBP1-56919-img0002.jpg)
Western Blot: CPEB3 Antibody [NBP1-56919] - 721_B cell lysate, concentration 0.2-1 ug/ml.