F-box protein 15/FBXO15 Antibody

Name F-box protein 15/FBXO15 Antibody
Supplier Novus Biologicals
Catalog NBP1-56901
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXO15(F-box protein 15) The peptide sequence was selected from the N terminal of FBXO15. Peptide sequence QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXO15
Conjugate Unconjugated
Supplier Page Shop

Product images