Craniofacial Development Protein 1 Antibody
| Name | Craniofacial Development Protein 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57025 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Bovine |
| Antigen | Synthetic peptides corresponding to CFDP1 (craniofacial development protein 1) The peptide sequence was selected from the middle region of CFDP1. Peptide sequence GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CFDP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Craniofacial Development Protein 1 Antibody [NBP1-57025] - Sample Type: Bovine Brain extract (40ug) Primary Dilution: 1:1000 Secondary Antibody: Goat Anti-Rabbit IgG Secondary Dilution: 1:5000 Image Submitted By: Shintaro Iwashita Iwaki Meisei University.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29969_Craniofacial-Development-Protein-1-Antibody-Western-Blot-NBP1-57025-img0005.jpg)
Western Blot: Craniofacial Development Protein 1 Antibody [NBP1-57025] - Sample Type: Bovine Brain extract (40ug) Primary Dilution: 1:1000 Secondary Antibody: Goat Anti-Rabbit IgG Secondary Dilution: 1:5000 Image Submitted By: Shintaro Iwashita Iwaki Meisei University.
![Western Blot: Craniofacial Development Protein 1 Antibody [NBP1-57025] - NCI-H226 cell lysate, Antibody Titration: 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/29970_Craniofacial-Development-Protein-1-Antibody-Western-Blot-NBP1-57025-img0003.jpg)
Western Blot: Craniofacial Development Protein 1 Antibody [NBP1-57025] - NCI-H226 cell lysate, Antibody Titration: 0.2-1 ug/ml.