C1orf216 Antibody

Name C1orf216 Antibody
Supplier Novus Biologicals
Catalog NBP1-56944
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptides corresponding to C3ORF10 The peptide sequence was selected from the middle region of C3ORF10. Peptide sequence YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene BRK1
Conjugate Unconjugated
Supplier Page Shop

Product images