CCT6B Antibody
| Name | CCT6B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56939 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CCT6B(chaperonin containing TCP1, subunit 6B (zeta 2)) The peptide sequence was selected from the N terminal of CCT6B. Peptide sequence VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CCT6B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: CCT6B Antibody [NBP1-56939] - 293T cells lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7171_CCT6B-Antibody-Western-Blot-NBP1-56939-img0002.jpg)
![Western Blot: CCT6B Antibody [NBP1-56939] - 293T cells lysate, Antibody Titration: 1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7172_CCT6B-Antibody-Western-Blot-NBP1-56939-img0003.jpg)