SLC6A18 Antibody
| Name | SLC6A18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59903 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC6A18(solute carrier family 6, member 18) The peptide sequence was selected from the middle region of SLC6A18. Peptide sequence MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC6A18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC6A18 Antibody [NBP1-59903] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24502_SLC6A18-Antibody-Western-Blot-NBP1-59903-img0001.jpg)
Western Blot: SLC6A18 Antibody [NBP1-59903] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: SLC6A18 Antibody [NBP1-59903] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24503_SLC6A18-Antibody-Immunohistochemistry-Paraffin-NBP1-59903-img0002.jpg)
Immunohistochemistry-Paraffin: SLC6A18 Antibody [NBP1-59903] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.