ABCA5 Antibody
| Name | ABCA5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59809 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ABCA5(ATP-binding cassette, sub-family A (ABC1), member 5) The peptide sequence was selected from the C terminal of ABCA5. Peptide sequence HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ABCA5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ABCA5 Antibody [NBP1-59809] - Titration: 1 ug/ml Positive Control: MCF-7 whole cell lysates.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24292_ABCA5%2520Antibody-Western%2520Blot-NBP1-59809-img0003.jpg)
![Immunohistochemistry-Paraffin: ABCA5 Antibody [NBP1-59809] - Human Colon Tissue, antibody concentration 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24293_ABCA5%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59809-img0002.jpg)