SLC17A4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59883
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC17A4(solute carrier family 17 (sodium phosphate), member 4) The peptide sequence was selected from the middle region of SLC17A4. Peptide sequence YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC17A4
• Conjugate: Unconjugated