NHE8 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59888
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC9A8(solute carrier family 9 (sodium/hydrogen exchanger), member 8) The peptide sequence was selected from the middle region of SLC9A8. Peptide sequence AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQE
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC9A8
• Conjugate: Unconjugated