PLD3/Phospholipase D3 Antibody
| Name | PLD3/Phospholipase D3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59921 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PLD3/Phospholipase D3 The peptide sequence was selected from the N terminal of PLD3/Phospholipase D3. Peptide sequence WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PLD3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14629_PLD3-Phospholipase-D3-Antibody-Western-Blot-NBP1-59921-img0005.jpg)
Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0 ug/ml
![Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14630_PLD3-Phospholipase-D3-Antibody-Western-Blot-NBP1-59921-img0003.jpg)
Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Human Heart lysate, concentration 0.2-1 ug/ml.
![Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14631_PLD3-Phospholipase-D3-Antibody-Western-Blot-NBP1-59921-img0004.jpg)
Western Blot: PLD3/Phospholipase D3 Antibody [NBP1-59921] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.