TM9SF4 Antibody

Name TM9SF4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59965
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB FC
Species Reactivities Human
Antigen Synthetic peptides corresponding to TM9SF4(transmembrane 9 superfamily protein member 4) The peptide sequence was selected from the N terminal of TM9SF4 (NP_055557). Peptide sequence HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TM9SF4
Conjugate Unconjugated
Supplier Page Shop

Product images