Name | TM9SF4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59965 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB FC |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TM9SF4(transmembrane 9 superfamily protein member 4) The peptide sequence was selected from the N terminal of TM9SF4 (NP_055557). Peptide sequence HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | TM9SF4 |
Conjugate | Unconjugated |
Supplier Page | Shop |