PIGV Antibody
| Name | PIGV Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62449 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Synthetic peptides corresponding to PIGV(phosphatidylinositol glycan anchor biosynthesis, class V) The peptide sequence was selected from the N terminal of PIGV. Peptide sequence FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | PIGV |
| Supplier Page | Shop |
![Western Blot: PIGV Antibody [NBP1-62449] - Jurkat cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/28983_PIGV%2520Antibody-Western%2520Blot-NBP1-62449-img0001.jpg)
![Immunohistochemistry-Paraffin: PIGV Antibody [NBP1-62449] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_2/28984_PIGV%2520Antibody-Immunohistochemistry-Paraffin-NBP1-62449-img0003.jpg)