IFI44L Antibody
| Name | IFI44L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57838 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to IFI44L(interferon-induced protein 44-like) The peptide sequence was selected from the N terminal of IFI44L. Peptide sequence MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | IFI44L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: IFI44L Antibody [NBP1-57838] - Jurkat cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14323_IFI44L-Antibody-Western-Blot-NBP1-57838-img0001.jpg)
![Immunohistochemistry-Paraffin: IFI44L Antibody [NBP1-57838] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14324_IFI44L-Antibody-Immunohistochemistry-Paraffin-NBP1-57838-img0002.jpg)