Myosin heavy chain 1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57681
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide corresponding to Myosin heavy chain 1 (myosin, heavy chain 1, skeletal muscle, adult) directed towards the N terminal of Myosin heavy chain 1. Peptide sequence: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: MYH1
• Conjugate: Unconjugated