EPX Antibody
| Name | EPX Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58010 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EPX(eosinophil peroxidase) The peptide sequence was selected from the middle region of EPX. Peptide sequence LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EPX |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EPX Antibody [NBP1-58010] - Sample Tissue: MCF7, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6952_EPX-Antibody-Western-Blot-NBP1-58010-img0003.jpg)
Western Blot: EPX Antibody [NBP1-58010] - Sample Tissue: MCF7, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 0.12
![Western Blot: EPX Antibody [NBP1-58010] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6953_EPX-Antibody-Western-Blot-NBP1-58010-img0002.jpg)
Western Blot: EPX Antibody [NBP1-58010] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.