TCP1-eta Antibody

Name TCP1-eta Antibody
Supplier Novus Biologicals
Catalog NBP1-58218
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human
Antigen Synthetic peptides corresponding to CCT7(chaperonin containing TCP1, subunit 7 (eta)) The peptide sequence was selected from the middle region of CCT7. Peptide sequence RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CCT7
Conjugate Unconjugated
Supplier Page Shop

Product images