Kinesin C2 Antibody
| Name | Kinesin C2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58247 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to KIFC2 (kinesin family member C2) The peptide sequence was selected from the N terminal of KIFC2. Peptide sequence VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | KIFC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Kinesin C2 Antibody [NBP1-58247] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24431_Kinesin%2520C2%2520Antibody-Western%2520Blot-NBP1-58247-img0003.jpg)
![Immunohistochemistry-Paraffin: Kinesin C2 Antibody [NBP1-58247] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24432_Kinesin%2520C2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-58247-img0004.jpg)