Name | RNASEH2A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58235 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RNASEH2A (ribonuclease H2, subunit A) The peptide sequence was selected from the middle region of RNASEH2A. Peptide sequence AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | RNASEH2A |
Conjugate | Unconjugated |
Supplier Page | Shop |