Epsilon 1 Tubulin Antibody
| Name | Epsilon 1 Tubulin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58223 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TUBE1(tubulin, epsilon 1) The peptide sequence was selected from the middle region of TUBE1. Peptide sequence HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TUBE1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Epsilon 1 Tubulin Antibody [NBP1-58223] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19446_Epsilon-1-Tubulin-Antibody-Western-Blot-NBP1-58223-img0004.jpg)
![Immunohistochemistry-Paraffin: Epsilon 1 Tubulin Antibody [NBP1-58223] - Drosophila Melanogaster whole-mount brains tissue at an antibody concentration of 5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19447_Epsilon-1-Tubulin-Antibody-Immunohistochemistry-Paraffin-NBP1-58223-img0005.jpg)