Name | SDF2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58376 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SDF2(stromal cell-derived factor 2) The peptide sequence was selected from the N terminal of SDF2. Peptide sequence KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | SDF2 |
Conjugate | Unconjugated |
Supplier Page | Shop |