SDF2 Antibody
| Name | SDF2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58376 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SDF2(stromal cell-derived factor 2) The peptide sequence was selected from the N terminal of SDF2. Peptide sequence KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SDF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SDF2 Antibody [NBP1-58376] - This Anti-SDF2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24496_SDF2-Antibody-Western-Blot-NBP1-58376-img0001.jpg)
![Immunohistochemistry: SDF2 Antibody [NBP1-58376] - Analysis of Human kidney.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24497_SDF2-Antibody-Immunohistochemistry-NBP1-58376-img0002.jpg)